PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02556.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 428aa    MW: 50067.1 Da    PI: 7.351
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02556.1_g00005.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.38.5e-19219265148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              +g WT+eEd +lv++v+++G + W+ Ia+ ++ gR +kqc++rw+++l
  Rsa1.0_02556.1_g00005.1 219 KGQWTAEEDRILVQLVEKYGLRKWSHIAQVLP-GRIGKQCRERWHNHL 265
                              799*****************************.*************97 PP

2Myb_DNA-binding52.11.6e-16271313145
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                              +  W++eEd  l++ +k+ G++ W+ Ia++++ gRt++++k++w+
  Rsa1.0_02556.1_g00005.1 271 KETWSEEEDRVLIEFHKEIGNK-WAEIAKRLP-GRTENSIKNHWN 313
                              578*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.918214269IPR017930Myb domain
SuperFamilySSF466891.01E-32217312IPR009057Homeodomain-like
SMARTSM007174.6E-18218267IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-27220270IPR009057Homeodomain-like
CDDcd001673.76E-16222265No hitNo description
PfamPF139214.8E-20222279No hitNo description
PROSITE profilePS5129421.16270320IPR017930Myb domain
SMARTSM007174.8E-16270318IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-22271318IPR009057Homeodomain-like
CDDcd001672.38E-12273316No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 428 aa     Download sequence    Send to blast
MENYVDESGF APLNQTNFIH DQEHMKEEDF SFEVVDQSKP TSFLQDFHHL DHDHQFDHHY  60
HHHYHHHHGS TSSNPLLGIP KTLSCINNAP SEHCSYQENM VDSYESKPRL MNHHFQGSDN  120
QYFIRNHHQE ISLVDGHNPV DLEQNNMIMM RMLPFEYPPT EIIKPTNFMM PNEVSCVSAD  180
DNFYKAMSFN KTKHFLTRNL SSSSSSSSWK GKNKTTLVKG QWTAEEDRIL VQLVEKYGLR  240
KWSHIAQVLP GRIGKQCRER WHNHLKPDIK KETWSEEEDR VLIEFHKEIG NKWAEIAKRL  300
PGRTENSIKN HWNATKRRQF SKRKCRSKYP RPSLLQGYIK SLDLGVLSSS SVPARGRRKE  360
SNKKYVVAVE EKKKKKEEKF YGQDRIVPEF VFADGFGFNE NLFEEGCSID SLLDDLPQTD  420
IDAFVHGI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C4e-452173202105C-Myb DNA-Binding Domain
1msf_C4e-452173202105C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1356375RRKESNKKYVVAVEEKKKKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013654780.10.0PREDICTED: transcription factor MYB98-like
SwissprotQ9S7L20.0MYB98_ARATH; Transcription factor MYB98
TrEMBLA0A078FBH90.0A0A078FBH9_BRANA; BnaC03g62830D protein
STRINGBra020992.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58692847
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.10.0myb domain protein 98